PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn159211
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family LBD
Protein Properties Length: 162aa    MW: 17391.7 Da    PI: 6.3424
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn159211genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26035.13.7e-1129765097
      DUF260 50 peeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97
                 ++ ++++++sl++eA+ r+ +Pv+Gavg++++++++++q++++++l+
  Achn159211 29 IHKPKQALFQSLLFEACGRTVNPVNGAVGLLSTGNWHVCQTAVNTVLA 76
                4556899**********************************9988776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031952.4E-72974IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 162 aa     Download sequence    Send to blast
MTRDVISDSS LTFNPMVEKQ AAPFIDNHIH KPKQALFQSL LFEACGRTVN PVNGAVGLLS  60
TGNWHVCQTA VNTVLAGGTL RPLTAPILTH EASDAFDSSP KIWNFQKCFS EGAQRQPSDL  120
KTAATMTSDS GESEMVAGFH GGNYGAEKLR AEEPKLLNLF V*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004238097.23e-31PREDICTED: LOB domain-containing protein 38-like
SwissprotQ9SZE81e-25LBD39_ARATH; LOB domain-containing protein 39
TrEMBLA0A068TYW97e-33A0A068TYW9_COFCA; Uncharacterized protein
STRINGSolyc04g077990.2.18e-31(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9662490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37540.19e-27LOB domain-containing protein 39